PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G020400.1
Common NamePHAVU_008G020400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family TCP
Protein Properties Length: 359aa    MW: 40078.9 Da    PI: 9.0956
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G020400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP147.41e-45972312133
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec...eaesssssasnsssgk 89 
                         ++kkdrhskihT++g+RdRRvRls+e+a++fFdLqd+LGfdk+s+t++WL++++k+aikelt+++ s  s+    +++ +++s+ ++ +++
  Phvul.008G020400.1  97 TTKKDRHSKIHTSQGLRDRRVRLSIEIARKFFDLQDMLGFDKASNTLDWLFTKSKKAIKELTRSKHSVDSFEfssSSDGEVVSVIHQDKEQ 187
                         78**************************************************************555553323455566666777777777 PP

                 TCP  90 aaksaakskksqksaasalnlakesrakarararertrekmrik 133
                         ++  + ++ k +++  ++ +++kesr+karararert+ k + +
  Phvul.008G020400.1 188 HQGVDLEEGKLKEPVYCVKAKMKESREKARARARERTSCKGKVQ 231
                         77788899999999***********************9988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.0E-4197227IPR005333Transcription factor, TCP
PROSITE profilePS5136936.40199157IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137011.201210227IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MFPSSNYTSG SYPRFPSSSS SSTSPYPSFT FLHPENSSSS TFLHDPLSVT FIPTNYHAPI  60
PETLANWAVA DYAAAAMLNQ DLGGALYGIT KKPAKKTTKK DRHSKIHTSQ GLRDRRVRLS  120
IEIARKFFDL QDMLGFDKAS NTLDWLFTKS KKAIKELTRS KHSVDSFEFS SSSDGEVVSV  180
IHQDKEQHQG VDLEEGKLKE PVYCVKAKMK ESREKARARA RERTSCKGKV QEFNKNCPAT  240
ENHQILNQSR SDRNLIEDVN GGMTRDDDFN VIEESIVIKR KLKHSLMSSI HHQNAVIPKE  300
ASVNNSDYHS FPNLSPNWEA NSAANGRSTF CAIASMNLSA GLQIFGKSWE ECTNPHPT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139331.10.0hypothetical protein PHAVU_008G020400g
TrEMBLV7B1850.0V7B185_PHAVU; Uncharacterized protein
STRINGGLYMA08G28691.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17383294
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.22e-27TCP family protein